PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC052959.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 98aa    MW: 10644.6 Da    PI: 11.24
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC052959.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF871e-271059251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  ri +ks rqvtfskRr g++KKA EL vLCd++va+++fss+gklye++s
  EcC052959.20 10 RIADKSSRQVTFSKRRGGLMKKARELAVLCDVDVALVVFSSRGKLYEFCS 59
                  899*********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.9E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006630.179161IPR002100Transcription factor, MADS-box
CDDcd002651.38E-34261No hitNo description
SuperFamilySSF554558.11E-29261IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-27323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-273859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MGRRKVEIRR IADKSSRQVT FSKRRGGLMK KARELAVLCD VDVALVVFSS RGKLYEFCSG  60
DRCASPSIPS LCLSVSLCRA LAIASSLARS ASLVALRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-21161161MEF2C
5f28_B1e-21161161MEF2C
5f28_C1e-21161161MEF2C
5f28_D1e-21161161MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. May be involved in the control of flowering time. {ECO:0000269|PubMed:9339904, ECO:0000269|Ref.9}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010025294.13e-36PREDICTED: MADS-box protein FLOWERING LOCUS C
SwissprotQ9SAR14e-25MADS8_ORYSJ; MADS-box transcription factor 8
TrEMBLA0A059B7T86e-35A0A059B7T8_EUCGR; Uncharacterized protein
STRINGXP_010025294.11e-35(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65070.26e-18MIKC_MADS family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Jang YH, et al.
    Survey of rice proteins interacting with OsFCA and OsFY proteins which are homologous to the Arabidopsis flowering time proteins, FCA and FY.
    Plant Cell Physiol., 2009. 50(8): p. 1479-92
    [PMID:19561057]
  3. Cui R, et al.
    Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa).
    Plant J., 2010. 61(5): p. 767-81
    [PMID:20003164]
  4. Bai X, et al.
    Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice.
    Sci Rep, 2016. 6: p. 19022
    [PMID:26744119]