PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC052470.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 129aa    MW: 15016.1 Da    PI: 6.5363
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC052470.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.75.3e-271058250
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                  rien +nrqvtfskRrng++KKA+ELSvLCd+++a+i+fs+++++  +s
  EcC052470.10 10 RIENITNRQVTFSKRRNGLIKKAYELSVLCDIDIALIMFSPSDRVSHFS 58
                  8*******************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.791161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.06E-29283IPR002100Transcription factor, MADS-box
CDDcd002653.81E-33275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-25323IPR002100Transcription factor, MADS-box
PfamPF003192.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030001Biological Processmetal ion transport
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MGRVKLEIRR IENITNRQVT FSKRRNGLIK KAYELSVLCD IDIALIMFSP SDRVSHFSGK  60
RRIEDVFTRF INLTDQERDT TLQQLRNEND LALQLANPGA VDADAEELHQ QIGMLRQQLL  120
EAEEQIRYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-17159159MEF2 CHIMERA
6byy_B2e-17159159MEF2 CHIMERA
6byy_C2e-17159159MEF2 CHIMERA
6byy_D2e-17159159MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020410352.12e-66agamous-like MADS-box protein AGL104 isoform X3
SwissprotQ1PFC24e-60AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLA0A2I4H0X08e-63A0A2I4H0X0_JUGRE; agamous-like MADS-box protein AGL104 isoform X1
STRINGXP_010026056.11e-79(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.12e-62AGAMOUS-like 66
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]