PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC051478.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 256aa    MW: 27674.4 Da    PI: 8.7197
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC051478.50genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.12.2e-41491491101
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vh++FGasnv+k+l ++pe++r d+++slvyeA+ r+ dPvyG++g i++lqqq+++l+a+l+++
  EcC051478.50  49 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHRVFGASNVSKMLMEVPESQRADTANSLVYEANLRLTDPVYGCMGAISALQQQIQTLQAQLNAV 145
                   7***********************************************************************************************9 PP

        DUF260  98 keel 101
                   ++e+
  EcC051478.50 146 RNEI 149
                   9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.46348149IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4149146IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0006979Biological Processresponse to oxidative stress
GO:0007165Biological Processsignal transduction
GO:0009268Biological Processresponse to pH
GO:0055114Biological Processoxidation-reduction process
GO:0004601Molecular Functionperoxidase activity
GO:0004672Molecular Functionprotein kinase activity
GO:0005524Molecular FunctionATP binding
GO:0020037Molecular Functionheme binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGVGGARERL DEIAKKIKRE KDATYGDEMG RRHMMLSLSR TGTLNTITPC AACKLLRRRC  60
AEECPFSPYF SPHEPQKFAA VHRVFGASNV SKMLMEVPES QRADTANSLV YEANLRLTDP  120
VYGCMGAISA LQQQIQTLQA QLNAVRNEIL RFKYREAVTT NHVQSNVVVP HSRTALNPTA  180
ALAVSVVPPP TLSSSSSTAA PPDPSPPPLP PPPSLVVPSS SSSSSSTSSL FTPPTSTTTY  240
SSISSETNTV HYFEPI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045408.11e-178PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T51e-73LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A059DAZ40.0A0A059DAZ4_EUCGR; Uncharacterized protein
STRINGVIT_13s0067g02380.t013e-90(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.14e-72LOB domain-containing protein 15