PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC050990.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 193aa    MW: 21356 Da    PI: 4.9161
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC050990.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF62.54.7e-201961345
                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                  ie +s r+vtfskR +g++ KA ELS+LC+aevavi +s++++
  EcC050990.40 19 IEKESAREVTFSKRHQGLFRKAAELSILCGAEVAVIAYSPHDN 61
                  8999***********************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.787969IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-21968IPR002100Transcription factor, MADS-box
CDDcd001202.48E-241168No hitNo description
PRINTSPR004047.5E-151131IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.16E-221178IPR002100Transcription factor, MADS-box
PfamPF003195.8E-221965IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-153146IPR002100Transcription factor, MADS-box
PRINTSPR004047.5E-154667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005768Cellular Componentendosome
GO:0005802Cellular Componenttrans-Golgi network
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MEEAKRGPKS RRRVECGLIE KESAREVTFS KRHQGLFRKA AELSILCGAE VAVIAYSPHD  60
NPFAFAHPST PDALVAYYLS GGATRPTASE AATAHGKLEE DAVAKLQEAK REAEKIAAEP  120
GKRNRWWEEA AADGMSVEEL EQYVASLERL RKSLADRVGR CDDSDFYDRL LATDMDIGMD  180
LDAAFLAELQ YSC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010058861.11e-135PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLA0A059C6A34e-44A0A059C6A3_EUCGR; Uncharacterized protein
STRINGXP_010058861.11e-134(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.18e-21AGAMOUS-like 61