PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC050707.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 282aa    MW: 30695.1 Da    PI: 8.1476
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC050707.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.22.4e-401879263
        zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                  +e+alkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++sss
  EcC050707.10 18 PEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNRRSSS 79
                  7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-301676IPR003851Zinc finger, Dof-type
PfamPF027018.8E-342076IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5812276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MLVCTKPQQD NKKPRPQPEQ ALKCPRCDST NTKFCYYNNY SLSQPRYFCK SCRRYWTKGG  60
TLRNVPVGGG CRKNRRSSSS SSSSSKRAQD QQLLTSSANS VLNGLPGLST FDSSDLTLAF  120
ARLQKQASGQ FGLDDHDLPI LGKPNIHPSD VLGNHGGFLD SLRHGFIENH QGNFQNFYYG  180
HGGANAGDLM ENGCSAGEMG LGYDQEMSGP QTTAAVTMTT MKQELCSGGE GENRILWGFP  240
WQLNANYADG GNMMGDLDSA RGSGWSNGLS SPWHGLLNSP LM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032040.10.0PREDICTED: dof zinc finger protein DOF5.3
TrEMBLA0A059ABJ30.0A0A059ABJ3_EUCGR; Uncharacterized protein
STRINGGLYMA12G07710.11e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69602743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.15e-45Dof family protein