PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC050598.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 214aa    MW: 23459.4 Da    PI: 8.1804
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC050598.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601461.1e-4581071100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv+kll++l++++reda++sl+yeA++r+rdPvyG+vgvi+ lq+ql+ql+ +l  +
  EcC050598.10   8 PCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPHQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQMDLTCA 104
                   7*********************************************************************************************999 PP

        DUF260  98 kee 100
                   k+e
  EcC050598.10 105 KSE 107
                   876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.1727108IPR004883Lateral organ boundaries, LOB
PfamPF031956.8E-458105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016458Biological Processgene silencing
GO:0080111Biological ProcessDNA demethylation
GO:0005634Cellular Componentnucleus
GO:0003723Molecular FunctionRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MASSSTSPCA ACKFLRRKCQ PECVFAPYFP PDQPQKFANV HKVFGASNVT KLLNELHPHQ  60
REDAVNSLAY EADMRLRDPV YGCVGVISLL QHQLRQLQMD LTCAKSELSK YQSLGLAAGH  120
GLIAAAAAAA TTHNHPQNLG INLLGSASSR DHHHYHHQFF PRDHQHQMIR GFDAGSNYDA  180
GLLAMNVSAS IGQLGQFHQP RAAAGDDRRN IDPS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048503.11e-157PREDICTED: LOB domain-containing protein 6-like
RefseqXP_010048504.11e-157PREDICTED: LOB domain-containing protein 6-like
SwissprotO044793e-95LBD6_ARATH; LOB domain-containing protein 6
TrEMBLA0A059CS331e-157A0A059CS33_EUCGR; Uncharacterized protein
STRINGVIT_00s0340g00090.t011e-122(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.46e-93LBD family protein