PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC050485.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 156aa    MW: 18055.4 Da    PI: 8.3829
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC050485.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260102.92.9e-3271061100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   aCa+C+++r++C  +C +a+ fpa++  +f+ +++lFG++n++++++a+++e r++a++s+++e+++r +dPv+G++gv ++l+++++  +++l+ +
  EcC050485.10   7 ACASCRHQRKRCDGNCQYAELFPASRYDEFQDAQRLFGVNNMHNIVNAVEPEFRKQAAESILMEGNIRRSDPVHGCLGVARRLKWEIDLCQKQLEDT 103
                   7********************************************************************************************9988 PP

        DUF260  98 kee 100
                   +++
  EcC050485.10 104 NRH 106
                   765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.240.101.3E-4421IPR001138Zn(2)-C6 fungal-type DNA-binding domain
PROSITE profilePS5089122.0736107IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-297103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009690Biological Processcytokinin metabolic process
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0019139Molecular Functioncytokinin dehydrogenase activity
GO:0050660Molecular Functionflavin adenine dinucleotide binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MPAASKACAS CRHQRKRCDG NCQYAELFPA SRYDEFQDAQ RLFGVNNMHN IVNAVEPEFR  60
KQAAESILME GNIRRSDPVH GCLGVARRLK WEIDLCQKQL EDTNRHLSFL QQRDRELQRQ  120
RQGFNDTLVE LPPLLPAFFS NGGGVRSFYE QMQRNP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010050454.11e-114PREDICTED: LOB domain-containing protein 33-like
TrEMBLA0A067E2B93e-44A0A067E2B9_CITSI; Uncharacterized protein (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-22LOB domain-containing protein 22