PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC050250.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 218aa    MW: 23222.7 Da    PI: 4.3943
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC050250.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF38.31.7e-12244345
                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                  i++  +r+v fskR  +++KKAeEL +L++ +  + + sstg+
  EcC050250.10  2 ISDLQKRHVAFSKRCPTLFKKAEELAILTGSDLFLGVRSSTGR 44
                  88999****************************9999999996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.853152IPR002100Transcription factor, MADS-box
SMARTSM004321.2E-4151IPR002100Transcription factor, MADS-box
PfamPF003191.6E-12246IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-9250IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 218 aa     Download sequence    Send to blast
MISDLQKRHV AFSKRCPTLF KKAEELAILT GSDLFLGVRS STGRTFYSSY QRGKLIESNI  60
AHRKGKVNSV GHGDCESFWT SPVNSATGGT FDSMSSGLND DEFNMDELLN FSEDCIGDGD  120
RPENSAIRGP SNPTCSGLDG SEFNPDAFLD PSKDCIGHVK CQCCVSVCVG VGNGILSLPE  180
NSDAGGGRSG VELMRSGVEG DGYDPNDFLT LDDLGVSL
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.27e-07MIKC_MADS family protein