PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC049955.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family BBR-BPC
Protein Properties Length: 285aa    MW: 31507.2 Da    PI: 10.33
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC049955.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind329.77.9e-10112851301
     GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdaki.rernlalsekkaavaerd.........maflqrdkalaernkalverdnkllalll 86 
                   md d+s + rn+gyyep+a+++  lgl+lmss++e+     r++ +  +++ +a+++rd         m++ +rd++++         ++k+++ + 
  EcC049955.30   1 MDGDNSLNmRNWGYYEPTATMR-GLGLNLMSSVPEKPLFDsRSAAVMAASNGSAYHHRDlgasqavypMDY-MRDAWMSP--------REKFFNPMS 87 
                   899999999*********9998.9**********998765366666555566789****************.9******9........678888888 PP

     GAGA_bind  87 venslasalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesa 183
                    +++        ++++++t++++++q+++ p+l+       + e  ++ + +   +e+ e+  +kkr  +k pk++k kk+k+ ++++k +++++  
  EcC049955.30  88 GNHN--------YSMIPETSTAHHMQMVQPPDLS-------KDERATQVEQVGIGNEIIENGPSKKRPGPKGPKSPKPKKAKRGPRAPKAETAPSV- 168
                   7775........89*************5444443.......334444444455677788888888899999************9988877777776. PP

     GAGA_bind 184 derskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydls 280
                    +r+++ kk+++l +ng+++D+s +P+PvCsCtG+++qCY+WG+GGWqSaCCtt +S+yPLP+stkrrgaRiagrKmS gafkk+LekLaaeGy++ 
  EcC049955.30 169 -PRARTIKKTTELMINGINMDISCIPIPVCSCTGTPQQCYRWGSGGWQSACCTTGLSMYPLPMSTKRRGARIAGRKMSIGAFKKVLEKLAAEGYNFT 264
                   .89********************************************************************************************** PP

     GAGA_bind 281 npvDLkdhWAkHGtnkfvtir 301
                   np+DL++hWAkHGtnkfvtir
  EcC049955.30 265 NPIDLRTHWAKHGTNKFVTIR 285
                   ********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012264.1E-1561285IPR010409GAGA-binding transcriptional activator
PfamPF062171.3E-1111285IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009590Biological Processdetection of gravity
GO:0009959Biological Processnegative gravitropism
GO:0009965Biological Processleaf morphogenesis
GO:0010031Biological Processcircumnutation
GO:0010601Biological Processpositive regulation of auxin biosynthetic process
GO:0048444Biological Processfloral organ morphogenesis
GO:2000012Biological Processregulation of auxin polar transport
GO:2000904Biological Processregulation of starch metabolic process
GO:0005634Cellular Componentnucleus
GO:0003676Molecular Functionnucleic acid binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MDGDNSLNMR NWGYYEPTAT MRGLGLNLMS SVPEKPLFDS RSAAVMAASN GSAYHHRDLG  60
ASQAVYPMDY MRDAWMSPRE KFFNPMSGNH NYSMIPETST AHHMQMVQPP DLSKDERATQ  120
VEQVGIGNEI IENGPSKKRP GPKGPKSPKP KKAKRGPRAP KAETAPSVPR ARTIKKTTEL  180
MINGINMDIS CIPIPVCSCT GTPQQCYRWG SGGWQSACCT TGLSMYPLPM STKRRGARIA  240
GRKMSIGAFK KVLEKLAAEG YNFTNPIDLR THWAKHGTNK FVTIR
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. Negatively regulates the homeotic gene AGL11/STK, which controls ovule primordium identity, by a cooperative binding to purine-rich elements present in the regulatory sequence leading to DNA conformational changes. {ECO:0000269|PubMed:14731261, ECO:0000269|PubMed:15722463}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00254DAPTransfer from AT2G01940Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010069462.10.0PREDICTED: protein BASIC PENTACYSTEINE2
RefseqXP_010069463.10.0PREDICTED: protein BASIC PENTACYSTEINE2
SwissprotQ9SKD01e-82BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A059AVZ40.0A0A059AVZ4_EUCGR; Uncharacterized protein
STRINGXP_010069462.10.0(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.38e-83basic pentacysteine 2