PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC049096.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 160aa    MW: 17282.2 Da    PI: 8.3594
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC049096.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.84.4e-4471061100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk lrrkC+++Cv+apyfpa+qp+kfa+vhk+FGasnv+kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+ l++ela++
  EcC049096.10   7 PCAACKCLRRKCTQECVFAPYFPADQPQKFAYVHKVFGASNVTKLLNELNVSQREDAVNSLAYEAETRLRDPVYGCVGLISILQHKLDLLQKELASA 103
                   7***********************************************************************************************9 PP

        DUF260  98 kee 100
                   k+e
  EcC049096.10 104 KKE 106
                   987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6816107IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0005507Molecular Functioncopper ion binding
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
GO:0008270Molecular Functionzinc ion binding
GO:0016491Molecular Functionoxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MSSSNSPCAA CKCLRRKCTQ ECVFAPYFPA DQPQKFAYVH KVFGASNVTK LLNELNVSQR  60
EDAVNSLAYE AETRLRDPVY GCVGLISILQ HKLDLLQKEL ASAKKELATY VGPHAMIPTM  120
MQPSGAPPYM GNPSMSAVVP YNMMPMMGIP TAAAAGGPPL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010070501.11e-117PREDICTED: LOB domain-containing protein 36-like
RefseqXP_010070502.11e-117PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-71LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A061DMY03e-81A0A061DMY0_THECC; ASYMMETRIC LEAVES 2-like 1
TrEMBLA0A0B0PS922e-81A0A0B0PS92_G
STRINGPOPTR_0007s11460.16e-80(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.11e-68ASYMMETRIC LEAVES 2-like 1