PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC048829.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 151aa    MW: 16672.1 Da    PI: 10.7764
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC048829.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof102.62.4e-3275125252
        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvG 52 
                   ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalr   +G
  EcC048829.20  75 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRMSLLG 125
                   68999*****************************************76666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2474130IPR003851Zinc finger, Dof-type
PfamPF027016.2E-2777121IPR003851Zinc finger, Dof-type
PROSITE profilePS5088424.44679133IPR003851Zinc finger, Dof-type
PROSITE patternPS01361081117IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MANPSHGVQD SKGIKLFGAT ITLQGFRDQQ VKSEAPISTK ATTTMTTTTM KTTMTTTTST  60
TNRNQDALAE AMKRPDKIIP CPRCKSMETK FCYFNNYNVN QPRHFCKGCQ RYWTAGGALR  120
MSLLGLAAGR ASHRAGEWMG SQRVALSKGQ R
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052194.13e-72PREDICTED: dof zinc finger protein DOF1.5
SwissprotP683507e-42DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLA0A059CCD23e-72A0A059CCD2_EUCGR; Uncharacterized protein
STRINGAT1G29160.12e-39(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.12e-39Dof family protein