PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC048543.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 937aa    MW: 104798 Da    PI: 6.0459
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC048543.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.65.8e-29608659152
        RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                   aek i+l++l++yF++++k+AAk+Lgvc+T+LKriCRq+GIkRWP+Rkik++
  EcC048543.20 608 AEKAITLQVLRQYFAGSLKNAAKSLGVCPTTLKRICRQHGIKRWPSRKIKKV 659
                   5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.291598679IPR003035RWP-RK domain
PfamPF020422.2E-25612659IPR003035RWP-RK domain
SuperFamilySSF542775.33E-21827918No hitNo description
Gene3DG3DSA:3.10.20.2401.1E-20831914No hitNo description
PROSITE profilePS5174523.746833916IPR000270PB1 domain
SMARTSM006669.7E-21833916IPR000270PB1 domain
PfamPF005644.2E-15834915IPR000270PB1 domain
CDDcd064076.25E-37834914No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0016021Cellular Componentintegral component of membrane
GO:0005319Molecular Functionlipid transporter activity
GO:0005515Molecular Functionprotein binding
GO:0020037Molecular Functionheme binding
Sequence ? help Back to Top
Protein Sequence    Length: 937 aa     Download sequence    Send to blast
MEDTVFSPIP MPSTAPESTM DVDYMDELLL EGCWLETVNG SEFLQQSPPS FGAFFDSPCQ  60
WSALENIECN SSPNQLQKNN QELMQTPLHP GDSPMEEGQT KPLDNPQSLS VVECSSRSDK  120
HVNEGSDLRR RWWIGPRVSS GSTSSVMNRL IHSLDHIRDL TKDKDVLIQI WVPVNRGDRR  180
FLTTNDQPFS LNPSSKRLSK YREISVNYQF SAKEDSKELM GLPSRVFLGK IPEWTPDVRF  240
FRSDEYARVD HAQHFDVRGT LALPIFEQGS RTCLGVIEVV MTTQKIQYQP EIQSVCKALE  300
AFDLRSSEVF GNLSEESHWK SYEAAIPEIR EVLRSACETH GLPLAQTWVP CSQQGKGGCR  360
HSNENYVHCV STIDHACHVA DPLLQPFHEA CSEHHLLKGQ GVVGRAFQTN QPCFSSDITS  420
SGRTEYPLSH HARMFGLCAA VAIRLRSIHT GTADFVLEFF LPMDCKDHDK QKKMLGSLSI  480
IIQQVCQSLR VITNEELEEE TVLPEIPVPS EGRPQGEWSL EVESNYLERC SEEDLSWSAH  540
VEKVQQSDTV ASATQKARAG ESFVEKSLDF GQFQDSSTER GEDCSFYGEG RCSDAAREKT  600
GDKKRTKAEK AITLQVLRQY FAGSLKNAAK SLGVCPTTLK RICRQHGIKR WPSRKIKKVG  660
HSLQKLQLVM DTVRVQGAPG PLQIDSFYTN FPELASPNLS ITSPLSASNH GDHLQPLDTQ  720
PGALNFDSCA AVSKSTSSSC SHSSSSSQCC SSGTKQHPSI VDLVAEEHLV SDNNMDINPS  780
KMVQSHVELQ GSSQEEQKLL PRSQSRRSFN PNMENPPQPP PQYNCQASRE GDPLRVKVAF  840
ADENIRFRMQ KDWDLKDLWG EIARRFCIED TSKFDLKYLD DDSEWVLLTC DADLDECIDV  900
SRSSPGSTVK LSVRKSHHRR LGSSLGSGGP PRMHGAS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061177.10.0PREDICTED: protein NLP4-like
RefseqXP_010061178.10.0PREDICTED: protein NLP4-like
TrEMBLA0A059BPH80.0A0A059BPH8_EUCGR; Uncharacterized protein
STRINGPOPTR_0005s27310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19982777
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein