PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC048535.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 245aa    MW: 26093.7 Da    PI: 8.3756
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC048535.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.76.9e-401978261
        zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                  ++++lkcprCdstntkfCyynny+lsqPr+fCk+CrryWtkGGalrn+PvGgg+rk  k+
  EcC048535.10 19 EQEQLKCPRCDSTNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNIPVGGGTRKTAKR 78
                  57899***************************************************8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-271471IPR003851Zinc finger, Dof-type
PfamPF027012.3E-332177IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3392377IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102561IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MQQDPSSLFQ PTTRPQFPEQ EQLKCPRCDS TNTKFCYYNN YNLSQPRHFC KSCRRYWTKG  60
GALRNIPVGG GTRKTAKRAS SKSKRHNAGS GSDTGADHPQ APGSSQAHSR TAEEASQSPP  120
PGFVGPTLDL DPARFYGSPS DLERRMLDVN GSFSSLLGTS GPFLSILEGP NLNASGASSM  180
VRFGGLGDEV KPGHGHVPGS AREPGAAADG AENFMDIQNG DAGCWTGGSG WPDLAIYTPG  240
SSFHR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00199DAPTransfer from AT1G51700Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033797.11e-173PREDICTED: dof zinc finger protein DOF3.1-like
SwissprotO821552e-41DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A059AHV01e-173A0A059AHV0_EUCGR; Uncharacterized protein
STRINGPOPTR_0003s02890.17e-68(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-37DOF zinc finger protein 1