PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC047873.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 345aa    MW: 38318 Da    PI: 6.7886
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC047873.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.3e-321064155
       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                  kprl+WtpeLH+rFveav qLGG++kAtPk+++++m+++gLtl+h+kSHLQkYRl
  EcC047873.10 10 KPRLKWTPELHHRFVEAVMQLGGADKATPKSLMRAMGIPGLTLYHLKSHLQKYRL 64
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.395767IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-30866IPR009057Homeodomain-like
SuperFamilySSF466896.45E-16965IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-221065IPR006447Myb domain, plants
PfamPF002492.1E-81263IPR001005SANT/Myb domain
PfamPF143791.3E-22114160IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
GO:0016614Molecular Functionoxidoreductase activity, acting on CH-OH group of donors
GO:0033897Molecular Functionribonuclease T2 activity
GO:0050660Molecular Functionflavin adenine dinucleotide binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MNLVLSTDAK PRLKWTPELH HRFVEAVMQL GGADKATPKS LMRAMGIPGL TLYHLKSHLQ  60
KYRLGKSQQS ESCIDTKQEG EFYATENKEV QSADEYQNTE IIDPSTFQMN ESLQIAQALQ  120
MQMEVQRKLH EQIEVQKHLQ LRIEAQGKYL QSVLRKAQET LARYNNSPVG IEAAKAELSQ  180
LVSMVSSGCP GSPFSELTEL GSSDLNDAAR KQLKGICSVE SSLTSSESSG RNEEKPKGNE  240
HGEMHNFSPT SIELRLSNIR PEEVPSQNIC NKTTGRKRCA SSGSDDNSLI AEQSSKSSPR  300
TSYKQKKCGL PVTLDLNSQY QADFDPGPKS IDLNFQGIEQ ANGHF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010066903.10.0PREDICTED: myb family transcription factor APL
TrEMBLA0A059BFT60.0A0A059BFT6_EUCGR; Uncharacterized protein
STRINGVIT_01s0026g02550.t011e-120(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.15e-81G2-like family protein