PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC047772.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family BBR-BPC
Protein Properties Length: 288aa    MW: 32174.9 Da    PI: 10.3205
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC047772.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind311.43e-95928816301
     GAGA_bind  16 paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvenslasalpvgvqvlsgtksidslq 112
                   ++++l+  +++++m ++ e++++i+er+ a +++kaa+ +rd+af qr++al er+kal+erdn+ +al++ en++++++    +  +g k +++  
  EcC047772.10   9 EKNALA--MNQKIMNILREKEQAIQERKDAEAQTKAAIGARDEAFRQREEALVERDKALMERDNARAALQYWENAINFTM--VGGNQHGLKRVHHPP 101
                   334555..99****************************************************************988655..334445666666666 PP

     GAGA_bind 113 qlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpk...ekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDes 206
                     s+ ++++      + ++++a+pi++ + +a + ++ k+++++k      +++++k k+ +e+   +v+  s+ ++++++++s d+ ln v ++ s
  EcC047772.10 102 Y-SQADIAEAL--NADVRITDAFPISSITADAIKPRQGKRSKEGKGIAlkgSSTQRKGKRVGEDL--NVQVLSHAKKVRSKWDSADVCLNLVVFNGS 193
                   5.334444443..4578889999999999999888888777766653300133344445544444..4555555588******************** PP

     GAGA_bind 207 tlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                   t+PvPvCsCtG++r CYkWGnGGWqS+CCttt+S+yPLP+ +++r+aR++grKmS+++f+klL++LaaeG dls p+DLkd+WAkHGtn+++ti+
  EcC047772.10 194 TMPVPVCSCTGIPRHCYKWGNGGWQSSCCTTTLSMYPLPQIPHKRHARVSGRKMSGSVFTKLLSRLAAEGQDLSIPLDLKDYWAKHGTNRYITIK 288
                   **********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012268.7E-1091288IPR010409GAGA-binding transcriptional activator
PfamPF062171.8E-898288IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046686Biological Processresponse to cadmium ion
GO:0055114Biological Processoxidation-reduction process
GO:0005829Cellular Componentcytosol
GO:0016491Molecular Functionoxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MAPQHQMKEK NALAMNQKIM NILREKEQAI QERKDAEAQT KAAIGARDEA FRQREEALVE  60
RDKALMERDN ARAALQYWEN AINFTMVGGN QHGLKRVHHP PYSQADIAEA LNADVRITDA  120
FPISSITADA IKPRQGKRSK EGKGIALKGS STQRKGKRVG EDLNVQVLSH AKKVRSKWDS  180
ADVCLNLVVF NGSTMPVPVC SCTGIPRHCY KWGNGGWQSS CCTTTLSMYP LPQIPHKRHA  240
RVSGRKMSGS VFTKLLSRLA AEGQDLSIPL DLKDYWAKHG TNRYITIK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028658.10.0PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
RefseqXP_010028660.10.0PREDICTED: protein BASIC PENTACYSTEINE4 isoform X2
RefseqXP_018718766.10.0PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
RefseqXP_018718768.10.0PREDICTED: protein BASIC PENTACYSTEINE4 isoform X1
SwissprotQ8S8C61e-108BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLA0A059ANB00.0A0A059ANB0_EUCGR; Uncharacterized protein
STRINGXP_010028658.10.0(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.21e-111basic pentacysteine 4