PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC047453.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YB
Protein Properties Length: 260aa    MW: 29197.6 Da    PI: 6.5858
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC047453.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB175.64.9e-5588184197
         NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                   vreqdrf+Pianv+rim+k+lP +akis+daket+qecvse+isf+t+ea+d+cqre+rkti+++d+lwa+++lGf+dy+epl++yl++yre+eg++
  EcC047453.30  88 VREQDRFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANDRCQREQRKTITAEDVLWAMSKLGFDDYIEPLTIYLHRYREIEGDR 184
                   69*********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.7E-5183186IPR009072Histone-fold
SuperFamilySSF471132.02E-3891187IPR009072Histone-fold
PfamPF008081.2E-2594158IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.1E-16122140No hitNo description
PROSITE patternPS006850125141IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.1E-16141159No hitNo description
PRINTSPR006152.1E-16160178No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006875Biological Processcellular metal ion homeostasis
GO:0055072Biological Processiron ion homeostasis
GO:0055085Biological Processtransmembrane transport
GO:1990388Biological Processxylem-to-phloem iron transport
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0008168Molecular Functionmethyltransferase activity
GO:0016787Molecular Functionhydrolase activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046915Molecular Functiontransition metal ion transmembrane transporter activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MVLDQNASSA FPTALFSIVF FVQVATATLR PYHHQTYRDR EGGRVDLTVR VEMERGFHGY  60
RKLPSNTAAN NNNGNHHLNA DENNECTVRE QDRFMPIANV IRIMRKILPP HAKISDDAKE  120
TIQECVSEYI SFITGEANDR CQREQRKTIT AEDVLWAMSK LGFDDYIEPL TIYLHRYREI  180
EGDRGSLRSE PFMKRVVDYS NLGVPPTAFA RGFPMAGPAG PHHAYFGAPP MGGYYKDGNT  240
SHEGSSNGAI GNGEAHGQFE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A2e-6187179597NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018729096.11e-151PREDICTED: nuclear transcription factor Y subunit B-6
SwissprotQ84W665e-69NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A059C9R31e-142A0A059C9R3_EUCGR; Uncharacterized protein
STRINGXP_010059546.11e-150(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-67nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Jia H,McCarty DR,Suzuki M
    Distinct roles of LAFL network genes in promoting the embryonic seedling fate in the absence of VAL repression.
    Plant Physiol., 2013. 163(3): p. 1293-305
    [PMID:24043445]
  2. Kim HU, et al.
    Ectopic overexpression of castor bean LEAFY COTYLEDON2 (LEC2) in Arabidopsis triggers the expression of genes that encode regulators of seed maturation and oil body proteins in vegetative tissues.
    FEBS Open Bio, 2013. 4: p. 25-32
    [PMID:24363987]
  3. Gnesutta N,Saad D,Chaves-Sanjuan A,Mantovani R,Nardini M
    Crystal Structure of the Arabidopsis thaliana L1L/NF-YC3 Histone-fold Dimer Reveals Specificities of the LEC1 Family of NF-Y Subunits in Plants.
    Mol Plant, 2017. 10(4): p. 645-648
    [PMID:27871811]
  4. Li D, et al.
    MYB89 Transcription Factor Represses Seed Oil Accumulation.
    Plant Physiol., 2017. 173(2): p. 1211-1225
    [PMID:27932421]
  5. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  6. Han JD, et al.
    Evolutionary Analysis of the LAFL Genes Involved in the Land Plant Seed Maturation Program.
    Front Plant Sci, 2017. 8: p. 439
    [PMID:28421087]