PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC047406.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 228aa    MW: 24904.5 Da    PI: 6.2477
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC047406.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.21.2e-42771761100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q++ l+++la++
  EcC047406.40  77 PCAACKILRRRCVDKCVLAPYFPPTEPYKFTIAHRVFGASNIIKFLQELPEPQRADAVSSMVYEANARIRDPVYGCAGAICHLQKQVSDLQEQLAKT 173
                   7***********************************************************************************************9 PP

        DUF260  98 kee 100
                   ++e
  EcC047406.40 174 QAE 176
                   987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.08776177IPR004883Lateral organ boundaries, LOB
PfamPF031959.7E-4377174IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009767Biological Processphotosynthetic electron transport chain
GO:0015977Biological Processcarbon fixation
GO:0005739Cellular Componentmitochondrion
GO:0009521Cellular Componentphotosystem
GO:0004848Molecular Functionureidoglycolate hydrolase activity
GO:0016168Molecular Functionchlorophyll binding
GO:0016984Molecular Functionribulose-bisphosphate carboxylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MEMEYKARTT TIPAPVTIPT KVFFPYSTSS SSSSPPPQPP SSQSSSPTTP PPHPPPPPSS  60
LPITPLPPPP PPAVLSPCAA CKILRRRCVD KCVLAPYFPP TEPYKFTIAH RVFGASNIIK  120
FLQELPEPQR ADAVSSMVYE ANARIRDPVY GCAGAICHLQ KQVSDLQEQL AKTQAELVNL  180
ELQRANLVAA CMEMAQSQEP NINFQQQLAD STGFLEDGSA SWESIYWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032234.11e-165PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR08e-75LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A059ACR71e-165A0A059ACR7_EUCGR; Uncharacterized protein
STRINGPOPTR_0008s04350.13e-82(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-74LOB domain-containing protein 1