PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC047326.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GeBP
Protein Properties Length: 286aa    MW: 32875 Da    PI: 5.3085
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC047326.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57358.71.6e-1883174397
        DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                   +++ w++ De+ lL+ l++f a+++ +p+ d+ ++y+f+++ ++  ++k+q+ +K+  LK K+++ v+    gk+++  ++++  ++ ls+k+W+
  EcC047326.30  83 MRKYWNKADELRLLRRLLEFSARKKENPVYDWGDIYKFISRDLETFYTKHQVRNKVYTLKSKYRDWVRL---GKKKQGMSPDELAAYRLSRKLWR 174
                   5788**************************************************************999...88888999**************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045049.0E-1885173IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007018Biological Processmicrotubule-based movement
GO:0009971Biological Processanastral spindle assembly involved in male meiosis
GO:0005634Cellular Componentnucleus
GO:0009524Cellular Componentphragmoplast
GO:0005524Molecular FunctionATP binding
GO:0008017Molecular Functionmicrotubule binding
GO:0008569Molecular FunctionATP-dependent microtubule motor activity, minus-end-directed
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
GQKIRSKLER SPAQRRRIAP SLPPMESPPA SPAPEDEVSE VTQTHEEDRD ADPEEEEEEE  60
DYDEEETAKS RDGTRAKKGP DLMRKYWNKA DELRLLRRLL EFSARKKENP VYDWGDIYKF  120
ISRDLETFYT KHQVRNKVYT LKSKYRDWVR LGKKKQGMSP DELAAYRLSR KLWRDEVKGE  180
SSGRSNGDGK AERGDRTALA ALKAELLVFD RMPEGMGSGF LSEVKRFGAV GVDEEFLRAG  240
LGLIEREKRA ELEERWRKLQ MAELAALAER AELIGLVAEA ILEASE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059432.11e-139PREDICTED: probable transcription factor At1g61730
TrEMBLA0A059CAA21e-140A0A059CAA2_EUCGR; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25650.19e-08DNA-binding storekeeper protein-related transcriptional regulator