PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC047148.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family CPP
Protein Properties Length: 681aa    MW: 74551.5 Da    PI: 5.3839
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC047148.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.12.7e-16384422240
           TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                   ++k+CnCkkskClk+YCeCfaag++C e C C+dC+Nk 
  EcC047148.10 384 TCKRCNCKKSKCLKLYCECFAAGVYCIEPCACQDCFNKP 422
                   689**********************************96 PP

2TCR50.63.7e-16469507139
           TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                   ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  EcC047148.10 469 RHKRGCNCKKSSCLKKYCECYQGGVGCSINCRCEGCKNA 507
                   589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.2E-18383424IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.799384509IPR005172CRC domain
PfamPF036389.8E-12386421IPR005172CRC domain
SMARTSM011141.0E-16469510IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11471507IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
DSPVFNYINS LSPIKPVKSI RITQAFSSLT FGSLPSIFTS PHVSSSHKES RFLRSHQDSD  60
PSNIGTSCKD ENKIPTAERN VSDVAQLAEN ESELQENFDI LVPIGESSVE PLDEHQEFAL  120
DLPQSLKYDC GSPNSDPTPC STAADCTVSK SDAPVVEKNS QIDLPDGRLH QEGTSQQKND  180
TGCGWESMAL ESTDLLIFSS PNDAAAFRGL IQRSPDVEVG YFTSMVSNFP ENEVSEELKR  240
QLLYQLTFNE QLEAEEPSCQ PVDPSEQKDT NTLPNGVAIS NLDNHTGTYL SVNMDNEAGA  300
HIPFANKPIS DLPRGMRRRC LDFEMAGTQQ KCLDGGSGGN SSPLLKSDEN NIPKNKQLVV  360
VKGGGDSSRC IVPRRMENGG ESETCKRCNC KKSKCLKLYC ECFAAGVYCI EPCACQDCFN  420
KPIHEDTVLA TRKQIESRNP LAFAPKVIRS SESASEYGED SSKTPASARH KRGCNCKKSS  480
CLKKYCECYQ GGVGCSINCR CEGCKNAFGT KDGSALRGPD CEEEEETEKC EKNKAEKIPW  540
KMENENNDEL NLASALPSTP SGFRRPLVQL AFPSKLKQPR SSFVTIGSSY ALHSSQKMGK  600
PDLLLPPPPK FEKLPLTNME DEIPEILCSS STPTATIKST SPNSKRVSPP HSDFGTSPNL  660
RSGRRLILQS IPSFPSLTPQ H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-1838850614120Protein lin-54 homolog
5fd3_B6e-1838850614120Protein lin-54 homolog
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010034650.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLA0A059D0A80.0A0A059D0A8_EUCGR; Uncharacterized protein
STRINGXP_010034650.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-138TESMIN/TSO1-like CXC 2