PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC047005.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YB
Protein Properties Length: 111aa    MW: 12595 Da    PI: 4.5469
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC047005.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB62.77.8e-201182374
         NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatl 74
                  ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +v+se+++ c+re+++ti+++ +l al  l
  EcC047005.20 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNEVCNREEKRTIAPEHVLKALEVL 82
                  6899***************************************************************99766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.2E-28882IPR009072Histone-fold
SuperFamilySSF471138.06E-251282IPR009072Histone-fold
PfamPF008083.9E-221479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0015914Biological Processphospholipid transport
GO:0016021Cellular Componentintegral component of membrane
GO:0000287Molecular Functionmagnesium ion binding
GO:0004012Molecular Functionphospholipid-translocating ATPase activity
GO:0005524Molecular FunctionATP binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MDPMDIVGKS KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLVSSESNE  60
VCNREEKRTI APEHVLKALE VLFLVLFLFF YDTLALIIAF LLILHILLAS Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B9e-2512881287Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010031455.12e-53PREDICTED: protein Dr1 homolog isoform X1
RefseqXP_010031462.12e-53PREDICTED: protein Dr1 homolog isoform X1
RefseqXP_018723264.12e-53PREDICTED: protein Dr1 homolog isoform X1
RefseqXP_018723265.12e-53PREDICTED: protein Dr1 homolog isoform X1
SwissprotP495921e-52NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A2I0IIR33e-52A0A2I0IIR3_PUNGR; Uncharacterized protein
STRINGXP_010031447.19e-53(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.21e-52nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]