PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC046825.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 100aa    MW: 11467.8 Da    PI: 5.1324
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC046825.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.82.1e-21551551
                  SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  ++s  ++tf+kRrn ++KKA+ LS LCdaev +iifs tg+lyeyss
  EcC046825.20  5 SSSSDHITFAKRRNSLMKKAKDLSQLCDAEVGIIIFSCTGQLYEYSS 51
                  678899***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.554153IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-12452IPR002100Transcription factor, MADS-box
PfamPF003191.8E-18649IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.09E-22766IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-141530IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-143051IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MNPHSSSSDH ITFAKRRNSL MKKAKDLSQL CDAEVGIIIF SCTGQLYEYS SSSMDSVIER  60
YTNLKREAQP ELDQPTFDAR VLEEEIANLN RQLQGLQEYH
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029963.11e-66PREDICTED: MADS-box transcription factor 23 isoform X2
RefseqXP_018717722.11e-67PREDICTED: MADS-box transcription factor 27 isoform X3
SwissprotA2RVQ56e-30AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLA0A059ATD05e-50A0A059ATD0_EUCGR; Uncharacterized protein
STRINGXP_010029960.17e-66(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.13e-32AGAMOUS-like 16
Publications ? help Back to Top
  1. Yang K,Jiang M,Le J
    A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell.
    J Integr Plant Biol, 2014. 56(6): p. 539-49
    [PMID:24386951]