PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC046149.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GeBP
Protein Properties Length: 288aa    MW: 32286.7 Da    PI: 7.9623
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC046149.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF5731011e-3176170297
        DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                   +fq++w ++Dei+lLqG+id+  ++g++p+++++afy+ vk+ +  ++++sql +K+r +KkK+++++ k k g++ +fs++h+ kifelsk iWg
  EcC046149.20  76 AFQKIWGDDDEITLLQGIIDY-CEKGMDPFSNVSAFYHDVKGLLREDFTESQLANKVRVFKKKYRNNKGKGKVGEDRVFSNSHEGKIFELSKTIWG 170
                   59*******************.899**********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.6E-2677170IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSSKRKVLVK EKLPAAKSDN EQKNNEESPS QPKPAPPRPQ KSAPSLKKLK TVPSTSLKQV  60
EVEKLGHAGE ESKKLAFQKI WGDDDEITLL QGIIDYCEKG MDPFSNVSAF YHDVKGLLRE  120
DFTESQLANK VRVFKKKYRN NKGKGKVGED RVFSNSHEGK IFELSKTIWG VEMRGNATSG  180
REEIGVTIEN KKTDGAGMFV APPWSKSEAS KSNDSQELLD DISHMCRIGL DEGSLNQGLA  240
LLEPSKRAEL NERWSKLFCA EMQIVAERCA VIEDQLKLIL EAYYHSTE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010039675.10.0PREDICTED: mediator-associated protein 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.17e-19DNA-binding storekeeper protein-related transcriptional regulator