PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC045318.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family VOZ
Protein Properties Length: 471aa    MW: 52439.8 Da    PI: 5.8607
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC045318.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ447.71.3e-1371954111217
           VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelfd 97 
                   pppsaflgpkcalwdc+rpaqg ew+qdycssfha+lalneg+pg++pvlrp+gi+lkdgllfaalsak+qgk+vgipecegaatakspwna+elfd
  EcC045318.40 195 PPPSAFLGPKCALWDCPRPAQGLEWCQDYCSSFHAALALNEGPPGMSPVLRPGGIGLKDGLLFAALSAKAQGKDVGIPECEGAATAKSPWNAPELFD 291
                   89*********************************************************************************************** PP

           VOZ  98 lsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekk 194
                   ls+legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp+++fewhlyeyein++da+alyrlelklvd+kk
  EcC045318.40 292 LSVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNHFEWHLYEYEINKYDACALYRLELKLVDGKK 388
                   ************************************************************************************************* PP

           VOZ 195 sakgkvskdsladlqkklgrlta 217
                   ++kg+v++dsladlqk++grlta
  EcC045318.40 389 NPKGRVANDSLADLQKQMGRLTA 411
                   *********************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MGKGSKNYCK SASHKLFKDK AKNRVDDLQG MFVDLQYARK ESRNVDVVVL EEQVHQMLRE  60
WKAELNEPSP ASSLHKLLQL CEEEDDATSA LTPPKAEPND QNLNIGDGTN LAEGLNSKPR  120
PQKRCFPSAD QCKDSHVAIG AAAIDTVDGI NSLEQLQFGL NQGFNQSYYD NYNSTGFGGE  180
DTMPHVTNCL PSICPPPSAF LGPKCALWDC PRPAQGLEWC QDYCSSFHAA LALNEGPPGM  240
SPVLRPGGIG LKDGLLFAAL SAKAQGKDVG IPECEGAATA KSPWNAPELF DLSVLEGETI  300
REWLFFDKPR RAFESGNRKQ RSLPDYSGRG WHESRKQVMN EFGGLKRSYY MDPQPLNHFE  360
WHLYEYEINK YDACALYRLE LKLVDGKKNP KGRVANDSLA DLQKQMGRLT AEFPPDSKRS  420
VKGRTKVNSK DSVGYMYSDQ NHGAAANEIV DYGLVSPYDY LVENKGEYYV T
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010057344.10.0PREDICTED: transcription factor VOZ1
RefseqXP_010057345.10.0PREDICTED: transcription factor VOZ1
RefseqXP_010057346.10.0PREDICTED: transcription factor VOZ1
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A059C8K50.0A0A059C8K5_EUCGR; Uncharacterized protein
STRINGXP_010057344.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66672745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]