PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC044345.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family SBP
Protein Properties Length: 174aa    MW: 19728.9 Da    PI: 8.5854
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC044345.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.53.5e-4255130277
                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                   Cq+e+C+adl+ea++yhrrhkvCe+h+kap+v+v gl qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk+ 
  EcC044345.10  55 CQAEKCTADLTEARQYHRRHKVCEQHAKAPAVVVGGLYQRFCQQCSRFHELLEFDENKRSCRRRLAGHNERRRKNP 130
                   **************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-3248116IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.07752129IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-3854133IPR004333Transcription factor, SBP-box
PfamPF031106.4E-3255128IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 174 aa     Download sequence    Send to blast
MEKGKHRAFL EEKLKAEPAA ECEDGPGGGD GEDDDDSKRK KVPPSSGEQA RERNCQAEKC  60
TADLTEARQY HRRHKVCEQH AKAPAVVVGG LYQRFCQQCS RFHELLEFDE NKRSCRRRLA  120
GHNERRRKNP AEPHIEGSSG KAGGSTQMKE LVCGQVDNRG RIQENATYKH FQIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-3653128984squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035775.11e-107PREDICTED: squamosa promoter-binding protein 1-like
SwissprotQ387411e-41SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A059A0I21e-107A0A059A0I2_EUCGR; Uncharacterized protein
STRINGVIT_12s0028g03350.t011e-63(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.18e-42squamosa promoter binding protein-like 5