PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC043112.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 87aa    MW: 9719.27 Da    PI: 11.2949
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC043112.50genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.88.7e-161349541
                  SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
        SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                  n + r + + kR+ g++KKA E SvLC+++ +v++f 
  EcC043112.50 13 NARARRIAYEKRKDGLMKKAREFSVLCGVDTCVVVFP 49
                  78899******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.02E-17182IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.946148IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-11167IPR002100Transcription factor, MADS-box
CDDcd002664.41E-17287No hitNo description
PRINTSPR004045.2E-7323IPR002100Transcription factor, MADS-box
PfamPF003196.7E-161350IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-72338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MGRGKTPHGL VPNARARRIA YEKRKDGLMK KAREFSVLCG VDTCVVVFPE AAAAGGDRPT  60
APEVWPPDSR EARRIIERYR SAGRRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010023474.17e-53PREDICTED: MADS-box transcription factor 4
TrEMBLA0A059B0V52e-51A0A059B0V5_EUCGR; Uncharacterized protein
STRINGXP_010023474.13e-52(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.15e-19M-type_MADS family protein