PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC041379.60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 157aa    MW: 17629.6 Da    PI: 10.3688
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC041379.60genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.51.5e-171353545
                  SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
        SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                   ++ r vt+ kRr+g+ KKA+E  +LC++++++ii++++g 
  EcC041379.60 13 KERARRVTYEKRRKGLVKKAHEFTTLCGVDACMIIYGPEGS 53
                  67889*********************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-18160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006618.797152IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-20298IPR002100Transcription factor, MADS-box
CDDcd002661.67E-20287No hitNo description
PRINTSPR004043.7E-11323IPR002100Transcription factor, MADS-box
PfamPF003196.7E-181153IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004043.7E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042765Cellular ComponentGPI-anchor transamidase complex
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MGRGKLALEL IPKERARRVT YEKRRKGLVK KAHEFTTLCG VDACMIIYGP EGSATAAEPM  60
VWPASPENVK LVIEQYRSEG ADRRAKRTVG LPEFFVNRKR KVDAELAKAR LANWKVKYPV  120
SEAPIEGLSE EDLRRLLGSL GHKLEAAKAR LAVMKED
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010034643.11e-107PREDICTED: MADS-box protein GGM13
TrEMBLA0A059AH201e-106A0A059AH20_EUCGR; Uncharacterized protein
STRINGXP_010034643.11e-107(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.13e-22M-type_MADS family protein