PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC038726.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 175aa    MW: 19476.2 Da    PI: 6.5226
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC038726.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.78.4e-201761145
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                  k ie+k +r+vtfskR +g++ KA+EL +LC+aeva++ +s++g+
  EcC038726.30 17 KIIEDKNKREVTFSKRHQGMFRKASELAILCGAEVAIVAYSPHGN 61
                  579***************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.231969IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-23968IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-241079IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-161131IPR002100Transcription factor, MADS-box
PfamPF003195.8E-221965IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-163146IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-164667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055085Biological Processtransmembrane transport
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0022891Molecular Functionsubstrate-specific transmembrane transporter activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MAEAKKKSQG RRRVECKIIE DKNKREVTFS KRHQGMFRKA SELAILCGAE VAIVAYSPHG  60
NPFVFGHPGV DAVINRYMPD GVVTEVNEAA AAAAALRAVD KHKKEYQDAM SKLEEVRMAE  120
VDAGKRGAAG NSEGQMWWNE NVDDIMGVEE LDYYADSLER LMKMVADRVD NKPCA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010058863.11e-125PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A059C6A31e-124A0A059C6A3_EUCGR; Uncharacterized protein
STRINGXP_010058863.11e-124(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.19e-26AGAMOUS-like 62