PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC038575.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 263aa    MW: 29767.2 Da    PI: 4.2439
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC038575.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.13.6e-161258349
                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                  i +   r vt+skRr+g++ KA+ L+ LC+a++av++fs+ gk y +
  EcC038575.40 12 IADPAARLVTYSKRRKGLFNKASQLCRLCGARAAVLVFSPAGKPYSF 58
                  66777899**********************************98877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.469262IPR002100Transcription factor, MADS-box
SMARTSM004323.1E-20261IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-13424IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-21478IPR002100Transcription factor, MADS-box
PfamPF003194.2E-201258IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-132439IPR002100Transcription factor, MADS-box
PRINTSPR004049.6E-133960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006436Biological Processtryptophanyl-tRNA aminoacylation
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0004830Molecular Functiontryptophan-tRNA ligase activity
GO:0005524Molecular FunctionATP binding
GO:0005525Molecular FunctionGTP binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGKRRRTEIA EIADPAARLV TYSKRRKGLF NKASQLCRLC GARAAVLVFS PAGKPYSFGD  60
PSADEIIGDY LRHCDCDGDG DVTPPMDLTQ WADWMETEWE ACATEEDLES LILKYEAVRD  120
CARDKLKSLE EEASQVGVGG GESRILSAEE IDALXXXXXX XXXXXXXXXX XXXXXXXXXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXQLSA  240
VDSMPTTSLD LKICMSCCEY DEY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010046035.11e-101PREDICTED: MADS-box transcription factor 50-like
TrEMBLA0A059D1D12e-88A0A059D1D1_EUCGR; Uncharacterized protein (Fragment)
STRINGXP_010045950.11e-101(Eucalyptus grandis)
STRINGXP_010046035.11e-101(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.11e-20AGAMOUS-like 29