PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC037189.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 370aa    MW: 40615.3 Da    PI: 8.3155
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC037189.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.91.5e-17199253256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  EcC037189.20 199 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 253
                   778899***********************************************98 PP

2HD-ZIP_I/II126.71e-40199289192
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                   +kk+rlskeq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E d+e+Lkr++++l+een+rL+ke +eLr +lk
  EcC037189.20 199 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEIDCEYLKRCCETLTEENRRLQKELQELR-ALK 289
                   69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.4E-574154IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466892.14E-18191256IPR009057Homeodomain-like
PROSITE profilePS5007116.86195255IPR001356Homeobox domain
SMARTSM003896.5E-15197259IPR001356Homeobox domain
CDDcd000863.39E-15199256No hitNo description
PfamPF000464.9E-15199253IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.605.6E-17199253IPR009057Homeodomain-like
PROSITE patternPS000270230253IPR017970Homeobox, conserved site
SMARTSM003401.1E-25255298IPR003106Leucine zipper, homeobox-associated
PfamPF021834.2E-10255289IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MELALTLGDT SKPFSFLDKA PKMAGDKESG NRDLGFCMGL GVSGRSSRGG GDEEEDGDGD  60
KRESPATDRR HHQQHHPPST LLQLHLLPFS PTNPRNSHHS HKPSTSQFRL PWLTDHLGSE  120
PESSGGAGRG LDVNRFPAAE EAEQSSPNSA LSSFQMEFGI RSGGGAGFRS GSHKRVDMEG  180
DNERDCSRGS DDDDNGLTRK KLRLSKEQSA FLEESFKEHN TLNPKQKLAL AKQLNLRPRQ  240
VEVWFQNRRA RTKLKQTEID CEYLKRCCET LTEENRRLQK ELQELRALKT SQPFYMQLPA  300
TTLTMCPSCE RVATTTAPAS AASSPAAAAA AAAAAAPPLA KPKPRTYPFP HAPQLHHLPQ  360
AQPQAHQAAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1197203TRKKLRL
2247255RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036498.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotP466658e-98HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A059A1W80.0A0A059A1W8_EUCGR; Uncharacterized protein
STRINGPOPTR_0016s05890.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49282852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-73homeobox from Arabidopsis thaliana