PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC036971.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YB
Protein Properties Length: 237aa    MW: 26873.6 Da    PI: 6.7925
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC036971.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.37.1e-5641136297
         NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                   +eqdrflPianv+rimkkvlP+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfedyv plk+yl+kyre+egek
  EcC036971.20  41 KEQDRFLPIANVGRIMKKVLPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAVTTLGFEDYVVPLKTYLNKYREIEGEK 136
                   89*******************************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.9E-5435164IPR009072Histone-fold
SuperFamilySSF471131.11E-4143167IPR009072Histone-fold
PfamPF008083.0E-2846110IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-187492No hitNo description
PROSITE patternPS0068507793IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.5E-1893111No hitNo description
PRINTSPR006151.5E-18112130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005768Cellular Componentendosome
GO:0005802Cellular Componenttrans-Golgi network
GO:0008168Molecular Functionmethyltransferase activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MEEEIESHHG NVPNVVPRRR SSSPESPCSK TDHHHHHHSN KEQDRFLPIA NVGRIMKKVL  60
PGNGKISKDA KETVQECVSE FISFVTGEAS DKCQREKRKT INGDDIIWAV TTLGFEDYVV  120
PLKTYLNKYR EIEGEKLNVP KQQQRSCSSS DQQQPQQQHG MHQQPFDHQI HDHSTNMGFT  180
NNDNDSSNGF CSSASILSQP RPFGGTDHQP LISLPYSPSS IQKQLQHQDQ VDSLGQW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4441131292Transcription factor HapC (Eurofung)
4g92_B1e-4441131292Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010027624.11e-178PREDICTED: nuclear transcription factor Y subunit B-7
SwissprotQ9SIT93e-74NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLA0A059AK341e-177A0A059AK34_EUCGR; Uncharacterized protein
STRINGXP_010027624.11e-177(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.11e-68nuclear factor Y, subunit B7
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]