PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC034554.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 64aa    MW: 7118.31 Da    PI: 10.811
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC034554.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.52.1e-29959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  kri+n++ rqvtfskRrng+lKKA ELS+LCdaev vi+fs tgkly+++s
  EcC034554.10  9 KRIDNSTSRQVTFSKRRNGLLKKARELSILCDAEVGVIVFSCTGKLYDFAS 59
                  79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.707161IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.1E-29261IPR002100Transcription factor, MADS-box
CDDcd002651.17E-38260No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-30323IPR002100Transcription factor, MADS-box
PfamPF003192.4E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004049.7E-303859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 64 aa     Download sequence    Send to blast
MGRGKIAIKR IDNSTSRQVT FSKRRNGLLK KARELSILCD AEVGVIVFSC TGKLYDFASS  60
RLDP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-20163163MEF2C
5f28_B4e-20163163MEF2C
5f28_C4e-20163163MEF2C
5f28_D4e-20163163MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of flowering time in long-day photoperiod. Participates in the repression of FT expression and floral transition, by interacting closely with the FLC-SVP pathways (PubMed:24876250). Functions in the satellite meristemoid lineage of stomatal development (PubMed:17704216). {ECO:0000269|PubMed:17704216, ECO:0000269|PubMed:24876250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the micro RNA miR824. {ECO:0000269|PubMed:18579782}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018732447.18e-34PREDICTED: MADS-box transcription factor 23-like
SwissprotA2RVQ56e-32AGL16_ARATH; Agamous-like MADS-box protein AGL16
TrEMBLV7BTH42e-32V7BTH4_PHAVU; Uncharacterized protein
STRINGXP_010065739.16e-35(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.13e-34AGAMOUS-like 16
Publications ? help Back to Top
  1. Yang K,Jiang M,Le J
    A new loss-of-function allele 28y reveals a role of ARGONAUTE1 in limiting asymmetric division of stomatal lineage ground cell.
    J Integr Plant Biol, 2014. 56(6): p. 539-49
    [PMID:24386951]