PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC033625.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YB
Protein Properties Length: 120aa    MW: 13569.4 Da    PI: 5.9497
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC033625.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB157.22.7e-4913108297
         NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                   +eqdr+lPianv+rimk+vlP+nakisk++ket+qecvsefi+fvtseas+kc++e+rkt+ngdd++ a+ t+Gf+dy+  l+ yl+ yr legek
  EcC033625.10  13 KEQDRLLPIANVGRIMKQVLPSNAKISKQTKETMQECVSEFIGFVTSEASEKCRKERRKTVNGDDICCAMETMGFDDYAGLLRRYLHIYRGLEGEK 108
                   89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-468118IPR009072Histone-fold
SuperFamilySSF471131.43E-3515117IPR009072Histone-fold
PfamPF008082.0E-251882IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.4E-144664No hitNo description
PRINTSPR006156.4E-146583No hitNo description
PRINTSPR006156.4E-1484102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 120 aa     Download sequence    Send to blast
MEDNIGSDEG STKEQDRLLP IANVGRIMKQ VLPSNAKISK QTKETMQECV SEFIGFVTSE  60
ASEKCRKERR KTVNGDDICC AMETMGFDDY AGLLRRYLHI YRGLEGEKAN QVKAMNNTQQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4113102291Transcription factor HapC (Eurofung)
4g92_B2e-4113102291Transcription factor HapC (Eurofung)
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037376.13e-67PREDICTED: nuclear transcription factor Y subunit B-5
SwissprotO822487e-54NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A059D2P99e-83A0A059D2P9_EUCGR; Uncharacterized protein
STRINGXP_010037234.18e-72(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.13e-56nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]