PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC033227.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 157aa    MW: 17494.9 Da    PI: 8.4927
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC033227.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.72.2e-3971071101
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrr+C++dC+++pyfp+++p++fa+vh+++Gasnv k+++++p++ r ++++sl++e+++r++dPvyG+vg+i+ l+ q++++++ela++
  EcC033227.10   7 RCAACKYLRRRCPPDCIFSPYFPSNDPQRFACVHRIYGASNVGKMIQQTPTQMRAQVADSLYFESRCRIQDPVYGCVGIISLLHLQIHNAESELAKV 103
                   6************************************************************************************************ PP

        DUF260  98 keel 101
                   k+++
  EcC033227.10 104 KAQI 107
                   9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.0096107IPR004883Lateral organ boundaries, LOB
PfamPF031955.7E-387104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MSTISSRCAA CKYLRRRCPP DCIFSPYFPS NDPQRFACVH RIYGASNVGK MIQQTPTQMR  60
AQVADSLYFE SRCRIQDPVY GCVGIISLLH LQIHNAESEL AKVKAQIAFL NSDANREPSF  120
RPQLEGASNV NNLWSGQSSV EQHQIGSSTT HGPLAFM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010025110.11e-115PREDICTED: LOB domain-containing protein 24-like
SwissprotP594682e-53LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A059DJZ91e-115A0A059DJZ9_EUCGR; Uncharacterized protein
STRINGPOPTR_0012s13910.12e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.11e-54LOB domain-containing protein 24