PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC032696.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 188aa    MW: 21197.9 Da    PI: 5.7655
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC032696.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26091.21.3e-2813111199
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   aCaaC+++rrkC +dC  a+ fpa+ p++fan++ l+G +n+ +l + lp+e r++am+++++e+++ra d v G+++++++l  +++ ++ el ++
  EcC032696.30  13 ACAACRHQRRKCRPDCQWAEFFPAALPQTFANARSLYGLRNMNELTRLLPPELRRTAMETIIFESNVRAFDRVGGCYRMVRDLAARVRLVECELRHT 109
                   7********************************************************************************************9998 PP

        DUF260  98 ke 99 
                   ++
  EcC032696.30 110 HQ 111
                   87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.80712113IPR004883Lateral organ boundaries, LOB
PfamPF031959.0E-2713110IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006486Biological Processprotein glycosylation
GO:0045454Biological Processcell redox homeostasis
GO:0016020Cellular Componentmembrane
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
GO:0008378Molecular Functiongalactosyltransferase activity
GO:0009055Molecular Functionelectron carrier activity
GO:0015035Molecular Functionprotein disulfide oxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
TASASASKPD SRACAACRHQ RRKCRPDCQW AEFFPAALPQ TFANARSLYG LRNMNELTRL  60
LPPELRRTAM ETIIFESNVR AFDRVGGCYR MVRDLAARVR LVECELRHTH QLLALLRGSE  120
LSTDNNVEDD DLGLAQKSSE DQEVLMRDYF VTDDLGASTS SCRVDEPSGA NRVCQGDRLL  180
NFLDEQII
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010051281.11e-132PREDICTED: LOB domain-containing protein 22-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72980.17e-24LOB domain-containing protein 7