PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC031977.60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 128aa    MW: 14724.1 Da    PI: 10.897
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC031977.60genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF55.76.5e-181151343
                  --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
        SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                  i n+  r+ tf kR+ng++KK +ELS+LC+++++ i++ss 
  EcC031977.60 11 IANDAARKATFKKRKNGLMKKVSELSTLCGIDACAIVYSSY 51
                  899************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.596150IPR002100Transcription factor, MADS-box
CDDcd002662.10E-27285No hitNo description
SuperFamilySSF554556.02E-24295IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-9323IPR002100Transcription factor, MADS-box
PfamPF003191.1E-181150IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006574Biological Processvaline catabolic process
GO:0009409Biological Processresponse to cold
GO:0009733Biological Processresponse to auxin
GO:0009790Biological Processembryo development
GO:0003677Molecular FunctionDNA binding
GO:0003860Molecular Function3-hydroxyisobutyryl-CoA hydrolase activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 128 aa     Download sequence    Send to blast
MTRKKAALAY IANDAARKAT FKKRKNGLMK KVSELSTLCG IDACAIVYSS YQAEPEVWPS  60
TLGVRRAIAR FKNMSEMDQS KRMVNQQEFI RQRIVKAEEQ LKKQVHENRE REIVQVMYRP  120
SSGRGSRA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKAALAYIANDAARKATFKKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010058574.11e-80PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK35e-42AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A059C5R32e-79A0A059C5R3_EUCGR; Uncharacterized protein
STRINGXP_010058574.14e-80(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-44AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]