PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC031866.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 61aa    MW: 6943.12 Da    PI: 10.7062
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC031866.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.35.6e-30959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  k+i n++ rqvtfskRr g++KKAeELSvLCda+va+i+fss+gkl+ey+s
  EcC031866.10  9 KKITNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSSGKLFEYCS 59
                  689**********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.815161IPR002100Transcription factor, MADS-box
SMARTSM004325.5E-40160IPR002100Transcription factor, MADS-box
CDDcd002652.49E-34260No hitNo description
PRINTSPR004041.6E-28323IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-29360IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.9E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-283859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
MAREKIQIKK ITNSTARQVT FSKRRRGLFK KAEELSVLCD ADVALIVFSS SGKLFEYCSS  60
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-20160160MEF2 CHIMERA
6byy_B2e-20160160MEF2 CHIMERA
6byy_C2e-20160160MEF2 CHIMERA
6byy_D2e-20160160MEF2 CHIMERA
6bz1_A1e-20160160MEF2 CHIMERA
6bz1_B1e-20160160MEF2 CHIMERA
6bz1_C1e-20160160MEF2 CHIMERA
6bz1_D1e-20160160MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289637.16e-35MADS-box protein JOINTLESS
RefseqXP_010027953.17e-35PREDICTED: MADS-box protein JOINTLESS isoform X1
RefseqXP_018717707.17e-35PREDICTED: MADS-box protein JOINTLESS isoform X1
RefseqXP_018717708.17e-35PREDICTED: MADS-box protein JOINTLESS isoform X1
SwissprotQ9FVC13e-33SVP_ARATH; MADS-box protein SVP
TrEMBLA0A059AKT42e-33A0A059AKT4_EUCGR; Uncharacterized protein
TrEMBLQ7Y1U91e-33Q7Y1U9_9MYRT; SVP-like floral repressor
TrEMBLQ84LN91e-33Q84LN9_EUCGR; SVP-like floral repressor
STRINGXP_010027952.1<