PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC025915.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 184aa    MW: 20625.2 Da    PI: 10.1895
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC025915.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.65.8e-171563149
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                  k+ien+s r +tfskR+  i KKA+EL +LC+aev  + fs++g+ + +
  EcC025915.30 15 KQIENESSRLITFSKRKSSINKKASELVTLCGAEVGFVAFSPSGNPFSF 63
                  78*****************************************986666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.7E-16766IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-13929IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.0071467IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-211484IPR002100Transcription factor, MADS-box
PfamPF003191.2E-201763IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-132944IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-134465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0015074Biological ProcessDNA integration
GO:0003677Molecular FunctionDNA binding
GO:0046872Molecular Functionmetal ion binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MAGRQTGENP RPGMKQIENE SSRLITFSKR KSSINKKASE LVTLCGAEVG FVAFSPSGNP  60
FSFAHPSIDA VANRFLNRNP SPNNSSQALV ESYRQAKCKE LNQQHDELYN QIKAEKAQGK  120
ALKRLTKGKS DAAWWEAPIE ELNREELYQM KGRLEELKRS LRRSINQKTQ GEASGSSQGQ  180
ELEK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059060.11e-131PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLA0A059C6S21e-105A0A059C6S2_EUCGR; Uncharacterized protein (Fragment)
STRINGXP_010059060.11e-131(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-35AGAMOUS-like 61