PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC025836.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 140aa    MW: 15607.5 Da    PI: 10.7226
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC025836.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.84.3e-3748106260
        zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                   +++ lkcprCdstntkfCyynny+ sqPr+fCkaC+r+WtkGG+lrnvPvGggr++++ 
  EcC025836.10  48 PSEPLKCPRCDSTNTKFCYYNNYNKSQPRHFCKACKRHWTKGGTLRNVPVGGGRKNKRP 106
                   67899***********************************************9876664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2349105IPR003851Zinc finger, Dof-type
PfamPF027013.4E-3251104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.64352106IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MGLSTKQVSN DGFDWNQSLL QDHHQTLEIP KSLPMKRSLQ QQNQLNQPSE PLKCPRCDST  60
NTKFCYYNNY NKSQPRHFCK ACKRHWTKGG TLRNVPVGGG RKNKRPKPSH PSSAAANSSS  120
AASRRILTAN TTTASDAPVQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052346.13e-99PREDICTED: dof zinc finger protein DOF1.8-like isoform X1
SwissprotO821553e-32DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A059CDL12e-71A0A059CDL1_EUCGR; Uncharacterized protein
STRINGGLYMA13G31560.11e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-30TARGET OF MONOPTEROS 6