PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC025551.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 278aa    MW: 30872.6 Da    PI: 5.2856
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC025551.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260120.87.3e-38101091100
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   aCaaCk++rrkC++dC+lap fpa+qp+ f+nvhklFG+sn+lk+lk l+++++++am+s++ +A++r   Pv+G++g+i++lq q++q+k+el+++
  EcC025551.20  10 ACAACKYQRRKCKPDCPLAPFFPANQPEIFRNVHKLFGVSNILKILKGLHPNQKPIAMRSIIDQANMRDWYPVHGCYGLIQNLQYQIQQAKEELHAI 106
                   7*********************************************************************************************987 PP

        DUF260  98 kee 100
                    ++
  EcC025551.20 107 YAQ 109
                   665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.0019110IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-3610105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MTLKGGASQA CAACKYQRRK CKPDCPLAPF FPANQPEIFR NVHKLFGVSN ILKILKGLHP  60
NQKPIAMRSI IDQANMRDWY PVHGCYGLIQ NLQYQIQQAK EELHAIYAQL EMYRQQNQVS  120
PVPEDVPSQL ELGMAPPNGA LPLFHQTQQQ CSAAATLPVP QNHCSNNGGV AGYDSSSDVV  180
PKDNVENALW MQNQYANYSN SNAIQMAASQ PMDVQQEIVQ DYDELQPFFD TIDDTQSYKE  240
ACDSSSESSL KDTRQSIEHA GNNELKSAAA CFSLTSVN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010028622.10.0PREDICTED: LOB domain-containing protein 27
TrEMBLA0A067KG131e-112A0A067KG13_JATCU; Uncharacterized protein
STRINGPOPTR_0012s07390.11e-100(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-52LOB domain-containing protein 27