PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC023650.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family HD-ZIP
Protein Properties Length: 244aa    MW: 26913.2 Da    PI: 8.3789
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC023650.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.9e-1982136256
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  EcC023650.20  82 RKKLRLSKDQSAVLEESFKEHNTLNPKQKLALAKQLGLRPRQVEVWFQNRRARTK 136
                   788899***********************************************98 PP

2HD-ZIP_I/II131.23.9e-4282171191
   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                   +kk+rlsk+q+++LEesF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  EcC023650.20  82 RKKLRLSKDQSAVLEESFKEHNTLNPKQKLALAKQLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCESLTEENRRLQKEVQELR-AL 171
                   69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046189.2E-18151IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.608.5E-1967132IPR009057Homeodomain-like
SuperFamilySSF466898.36E-1971139IPR009057Homeodomain-like
PROSITE profilePS5007117.31378138IPR001356Homeobox domain
SMARTSM003897.1E-1780142IPR001356Homeobox domain
CDDcd000862.76E-1682139No hitNo description
PfamPF000462.0E-1682136IPR001356Homeobox domain
PRINTSPR000311.5E-5109118IPR000047Helix-turn-helix motif
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PRINTSPR000311.5E-5118134IPR000047Helix-turn-helix motif
SMARTSM003402.2E-27138181IPR003106Leucine zipper, homeobox-associated
PfamPF021831.3E-11138172IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006468Biological Processprotein phosphorylation
GO:0009409Biological Processresponse to cold
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0016567Biological Processprotein ubiquitination
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0004672Molecular Functionprotein kinase activity
GO:0004842Molecular Functionubiquitin-protein transferase activity
GO:0005515Molecular Functionprotein binding
GO:0005524Molecular FunctionATP binding
GO:0008270Molecular Functionzinc ion binding
GO:0016491Molecular Functionoxidoreductase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
RNSEARSFLR GIDVNREPSA GAAADYGEDE AGVSSPNSMA STVSGKRSER DHQSQTNGDD  60
LDNERASSRG GGSDEEDGDM SRKKLRLSKD QSAVLEESFK EHNTLNPKQK LALAKQLGLR  120
PRQVEVWFQN RRARTKLKQT EVDCEYLKRC CESLTEENRR LQKEVQELRA LKLSPQFYMH  180
LSPPTTLTMC PSCERVAAPS PPSAVGRPLA AVPAHPRPVP LINPWAPAAA PLAHAPFDAL  240
RSCS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18086SRKKLRL
2130138RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055469.11e-179PREDICTED: homeobox-leucine zipper protein HAT4-like isoform X2
SwissprotQ054661e-101HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLA0A059C1901e-179A0A059C190_EUCGR; Uncharacterized protein
STRINGVIT_00s0299g00100.t011e-116(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.13e-74homeobox protein 2