PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC020519.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 68aa    MW: 7528.9 Da    PI: 11.7988
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC020519.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF65.26.7e-211760245
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                  +i +   r vt+skRr+g++KKA+EL+ LC+a++avi+fs+ gk
  EcC020519.30 17 KIADRAARLVTYSKRRKGLFKKASELCRLCGARAAVIVFSPAGK 60
                  6889999***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.3E-24867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.862868IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-151030IPR002100Transcription factor, MADS-box
CDDcd001208.99E-221066No hitNo description
SuperFamilySSF554555.1E-221067IPR002100Transcription factor, MADS-box
PfamPF003192.0E-231764IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-153045IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-154566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
SRNPSVMGKR RRTEIAKIAD RAARLVTYSK RRKGLFKKAS ELCRLCGARA AVIVFSPAGK  60
PCSFFSDP
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010024520.12e-34PREDICTED: uncharacterized protein LOC104414983
RefseqXP_018715991.13e-35PREDICTED: agamous-like MADS-box protein AGL61
SwissprotQ4PSU45e-16AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLA0A059D1D12e-28A0A059D1D1_EUCGR; Uncharacterized protein (Fragment)
STRINGXP_010024520.16e-34(Eucalyptus grandis)
STRINGXP_010027015.13e-34(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-18AGAMOUS-like 61
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]