PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC018455.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Nin-like
Protein Properties Length: 345aa    MW: 37879.1 Da    PI: 6.1209
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC018455.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.65.8e-291667152
        RWP-RK  1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
                  aek++sl +l++yFs+++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  EcC018455.10 16 AEKTVSLGVLQQYFSGSLKDAAKSIGVCPTTLKRICRQHGISRWPSRKINKV 67
                  5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.654187IPR003035RWP-RK domain
PfamPF020425.3E-262067IPR003035RWP-RK domain
SuperFamilySSF542771.18E-23238329No hitNo description
Gene3DG3DSA:3.10.20.2402.3E-25242324No hitNo description
PROSITE profilePS5174519.998245327IPR000270PB1 domain
SMARTSM006661.9E-20245327IPR000270PB1 domain
CDDcd064071.77E-31246326No hitNo description
PfamPF005643.9E-17246326IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
VTSLSRRQHE KKRSTAEKTV SLGVLQQYFS GSLKDAAKSI GVCPTTLKRI CRQHGISRWP  60
SRKINKVNRS LKKIQTVLNS VQGVEGGLKF DPNTGGFVAA GSIQEFDAQK NFIPDKKPAV  120
QGEEASIEEE ERSIPFVCGN NSAIKLEDEY CVGGDHLGPS TSSLLDISHE EAKKSSISQI  180
EYREDSKSTA VDDGIVEHNR PASSSMTDSS DGSGSIMHGS SSSSQSFEEG KHSKERTSSH  240
DSGSKVTVKA TYKDDTIRFK FEPSDGCFQL YDEVSKRFKL QYGTFQLKYL DDEDEWVMLV  300
SDSDLQECLE IMEYVGTRTV KFLVRDVPAA MGSSGGSNCF LSGCS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010026047.10.0PREDICTED: protein NLP8-like
RefseqXP_010026639.10.0PREDICTED: protein NLP8-like
RefseqXP_010027198.10.0PREDICTED: protein NLP8-like
RefseqXP_010027821.10.0PREDICTED: protein NLP8-like
RefseqXP_010028556.10.0PREDICTED: protein NLP8-like
SwissprotO228643e-97NLP8_ARATH; Protein NLP8
TrEMBLA0A059DB610.0A0A059DB61_EUCGR; Uncharacterized protein
STRINGSolyc11g045350.1.11e-124(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.25e-88Nin-like family protein