PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC015474.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 341aa    MW: 37633.3 Da    PI: 7.6531
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC015474.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-333286155
       G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                  kprlrWt eLHerFv+av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  EcC015474.40 32 KPRLRWTVELHERFVDAVTQLGGPDKATPKTIMRVMGVKGLTLYHLKSHLQKFRL 86
                  79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-322987IPR009057Homeodomain-like
PROSITE profilePS5129412.3472989IPR017930Myb domain
SuperFamilySSF466891.51E-163187IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-233287IPR006447Myb domain, plants
PfamPF002491.0E-73484IPR001005SANT/Myb domain
PfamPF143797.5E-22125164IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0016620Molecular Functionoxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MFHPKKPSGM NSHERGMCVQ GDSGLVLTTD PKPRLRWTVE LHERFVDAVT QLGGPDKATP  60
KTIMRVMGVK GLTLYHLKSH LQKFRLGKQP HKEFNDHSIK DASALELQRS SASSSAMIGR  120
SMNEMQMEVQ RRLHEQLEVQ RHLQLRIEAQ GKYMQAMLEK ACQTLAGESM VLHNSSGAGY  180
HNHKTPSNMP NPMNSIGGGA PFVKDFGSSS PLNFPSFQDL NIYGGADQLD LHPNLDRPSL  240
SLDSYHLPSN NNNSHDNSGF GKKRPSPFVT GGSGKNPLLW SADDLPEHGH DQIHTPEMVD  300
SISVDIYEAK PPPALTGGGG GDEQKPLKPH RHDDHLFQQA G
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064096.10.0PREDICTED: myb family transcription factor APL isoform X2
SwissprotQ9SAK51e-109APL_ARATH; Myb family transcription factor APL
TrEMBLA0A059C0H30.0A0A059C0H3_EUCGR; Uncharacterized protein
STRINGVIT_19s0085g00890.t011e-135(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79430.21e-102G2-like family protein