PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC015434.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 101aa    MW: 11389.7 Da    PI: 6.3829
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC015434.30genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26050.65.5e-163554799
        DUF260 47 kalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                  +++p + r +a++++ yeA ar++dPvyG+vg+i++lqqq+ q ++e+ ++k 
  EcC015434.30  3 QQVPGHLRAEAAECISYEATARVQDPVYGCVGIITQLQQQITQIHSEIMKIKG 55
                  6789999****************************************988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.401157IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-13353IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005768Cellular Componentendosome
GO:0005802Cellular Componenttrans-Golgi network
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MEQQVPGHLR AEAAECISYE ATARVQDPVY GCVGIITQLQ QQITQIHSEI MKIKGEMVAH  60
RSAHPQHLPS PQPQGEPSWF SSTHRQEQDN FQSDKHLSGN F
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011046521.12e-22PREDICTED: LOB domain-containing protein 24-like
TrEMBLA0A059AKP73e-69A0A059AKP7_EUCGR; Uncharacterized protein
STRINGPOPTR_0010s25720.12e-17(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-11LOB domain-containing protein 24