PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC014811.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 194aa    MW: 20923.7 Da    PI: 8.1
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC014811.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.66.7e-4610108199
        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   +CaaCk+lrrkC ++C++apyfp e+p+kf nvhk+FGasnv+kll++lp+++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el+++
  EcC014811.10  10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFTNVHKIFGASNVTKLLNELPPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRLQKELETA 106
                   7*********************************************************************************************998 PP

        DUF260  98 ke 99 
                   ++
  EcC014811.10 107 NA 108
                   76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089128.0989110IPR004883Lateral organ boundaries, LOB
PfamPF031959.2E-4510107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MSSSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFT NVHKIFGASN VTKLLNELPP  60
HQREDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVQRLQ KELETANADL IRYACNGIPS  120
SAAIPGSNNP VQPVTLRQRA APLEFGGVGR PIGNEGGGAF YQAPLPPYPY PYPPLPWNDN  180
FGGDFNGGGG GGSM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037527.11e-141PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML42e-72LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A059A6761e-141A0A059A676_EUCGR; Uncharacterized protein
STRINGPOPTR_0015s09370.11e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.43e-71LBD family protein