PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC014594.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 95aa    MW: 10867.4 Da    PI: 9.9863
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC014594.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.61.4e-32959151
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  EcC014594.10  9 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59
                  79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006634.09161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-42160IPR002100Transcription factor, MADS-box
CDDcd002651.16E-45278No hitNo description
SuperFamilySSF554553.4E-34276IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-34323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-342338IPR002100Transcription factor, MADS-box
PRINTSPR004049.0E-343859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0004553Molecular Functionhydrolase activity, hydrolyzing O-glycosyl compounds
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTNRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN  60
SIRSTIERYK KANSDSSNTS TVTEINAQVG YFLFC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-22188191MEF2C
5f28_B2e-22188191MEF2C
5f28_C2e-22188191MEF2C
5f28_D2e-22188191MEF2C
6bz1_A1e-22182183MEF2 CHIMERA
6bz1_B1e-22182183MEF2 CHIMERA
6bz1_C1e-22182183MEF2 CHIMERA
6bz1_D1e-22182183MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269|PubMed:11828031, ECO:0000269|PubMed:16326928, ECO:0000269|PubMed:9869408}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001289639.11e-56glycogen debranching enzyme
SwissprotQ407049e-54MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A059BUE33e-55A0A059BUE3_EUCGR; Uncharacterized protein
TrEMBLC0STT13e-55C0STT1_EUCGR; Agamous-like protein
STRINGXP_010062407.15e-56(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09960.22e-54MIKC_MADS family protein
Publications ? help Back to Top
  1. Kyozuka J,Shimamoto K
    Ectopic expression of OsMADS3, a rice ortholog of AGAMOUS, caused a homeotic transformation of lodicules to stamens in transgenic rice plants.
    Plant Cell Physiol., 2002. 43(1): p. 130-5
    [PMID:11828031]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]