Plant Transcription Factor Database
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC011632.10
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family BBR-BPC
Protein Properties Length: 326aa    MW: 36365.6 Da    PI: 9.9778
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC011632.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
     GAGA_bind  18 aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla....salpvgvqvlsgtksids 110
                   +s+k     q+m ++aerda+++ernla+sekkaa+a+rd+af+qrd+a+aern+a +erdn++++l+++ensl+    s++p+g+q+++g+k++++
                   4555.....****************************************************************9999999***************** PP

     GAGA_bind 111 lqq.lse.pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesader...............skae 190
                    qq +++ + +++ a+++r+++ ++alpi+  a+ea++++++k++++ak   ++k+       +k+ kkvk+e++d +                k++
                   *995556899*******************998888888777775554443322222......22222222222222111333445667899989*** PP

     GAGA_bind 191 kksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkd 287
                   +k +dl+ln+v++D+st+P PvCsCtG+ rqCYkWGnGGWqS+CCtttiS+yPLP+++++r+aR++grKmS++af klL++LaaeGydls pvDLkd
                   ************************************************************************************************* PP

     GAGA_bind 288 hWAkHGtnkfvtir 301
  EcC011632.10 313 HWAKHGTNRYITIK 326
                   *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.2E-1551326IPR010409GAGA-binding transcriptional activator
PfamPF062173.4E-10226326IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0016614Molecular Functionoxidoreductase activity, acting on CH-OH group of donors
GO:0050660Molecular Functionflavin adenine dinucleotide binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052611.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_010052612.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_010052613.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_010052615.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_010052616.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_010052617.10.0PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-142BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A059CE000.0A0A059CE00_EUCGR; Uncharacterized protein
STRINGGLYMA04G02860.11e-176(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-130basic pentacysteine 6