PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC011632.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family BBR-BPC
Protein Properties Length: 326aa    MW: 36365.6 Da    PI: 9.9778
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC011632.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind387.52.1e-1183332618301
     GAGA_bind  18 aslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla....salpvgvqvlsgtksids 110
                   +s+k     q+m ++aerda+++ernla+sekkaa+a+rd+af+qrd+a+aern+a +erdn++++l+++ensl+    s++p+g+q+++g+k++++
  EcC011632.10  33 PSMK-----QIMGIMAERDAALQERNLAISEKKAAIADRDIAFHQRDMAIAERNNAYLERDNAIATLQYRENSLTsgniSSCPPGCQISRGVKHMHH 124
                   4555.....****************************************************************9999999***************** PP

     GAGA_bind 111 lqq.lse.pqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesader...............skae 190
                    qq +++ + +++ a+++r+++ ++alpi+  a+ea++++++k++++ak   ++k+       +k+ kkvk+e++d +                k++
  EcC011632.10 125 PQQqVHHvSSMSEAAYGTRDMHPSDALPISPVASEATRSRQTKRTKEAKAMSTSKK------APKTPKKVKRETDDLNkllngddgynkpfgvPKSD 215
                   *995556899*******************998888888777775554443322222......22222222222222111333445667899989*** PP

     GAGA_bind 191 kksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkd 287
                   +k +dl+ln+v++D+st+P PvCsCtG+ rqCYkWGnGGWqS+CCtttiS+yPLP+++++r+aR++grKmS++af klL++LaaeGydls pvDLkd
  EcC011632.10 216 WKGQDLGLNQVAFDDSTMPSPVCSCTGIARQCYKWGNGGWQSSCCTTTISMYPLPAVPNKRHARVGGRKMSGSAFGKLLSRLAAEGYDLSSPVDLKD 312
                   ************************************************************************************************* PP

     GAGA_bind 288 hWAkHGtnkfvtir 301
                   hWAkHGtn+++ti+
  EcC011632.10 313 HWAKHGTNRYITIK 326
                   *************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.2E-1551326IPR010409GAGA-binding transcriptional activator
PfamPF062173.4E-10226326IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0016614Molecular Functionoxidoreductase activity, acting on CH-OH group of donors
GO:0050660Molecular Functionflavin adenine dinucleotide binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MNWALLLKKR ALQAWCFYLV ICFTLQWLMQ HQPSMKQIMG IMAERDAALQ ERNLAISEKK  60
AAIADRDIAF HQRDMAIAER NNAYLERDNA IATLQYRENS LTSGNISSCP PGCQISRGVK  120
HMHHPQQQVH HVSSMSEAAY GTRDMHPSDA LPISPVASEA TRSRQTKRTK EAKAMSTSKK  180
APKTPKKVKR ETDDLNKLLN GDDGYNKPFG VPKSDWKGQD LGLNQVAFDD STMPSPVCSC  240
TGIARQCYKW GNGGWQSSCC TTTISMYPLP AVPNKRHARV GGRKMSGSAF GKLLSRLAAE  300
GYDLSSPVDL KDHWAKHGTN RYITIK
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000269|PubMed:14731261}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052611.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_010052612.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_010052613.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_010052615.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_010052616.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_018727567.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_018727568.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_018727569.10.0PREDICTED: protein BASIC PENTACYSTEINE6
RefseqXP_018727571.10.0PREDICTED: protein BASIC PENTACYSTEINE6
SwissprotQ8L9991e-141BPC6_ARATH; Protein BASIC PENTACYSTEINE6
TrEMBLA0A059CE000.0A0A059CE00_EUCGR; Uncharacterized protein
STRINGXP_010052611.10.0(Eucalyptus grandis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-130basic pentacysteine 6