PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC011260.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 388aa    MW: 43151.8 Da    PI: 9.576
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC011260.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.93.9e-32214267255
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  EcC011260.10 214 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 267
                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15211267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.0E-28212267IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-23214267IPR006447Myb domain, plants
PfamPF002492.6E-7215266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNAK SASWRRTAEE DVNLGFWKRA LDSRSHHSLP SSMAAKNDAR  60
FDLSLSNPRA GHNAVGGNTI PEGNNNVSYN HLHQGGNHIH SFQNQSQYSN SNHHHHMHQH  120
HHSVLQHQPQ GLSQELGFLR PIRGIPVYHQ NSSSAFPFAT QLQHLDPSPI HHPNSSNSLT  180
NSANSIASNL CHSHGLVRSR FLPRFPAKRS MRAPRMRWTT TLHARFVHAV ELLGGHERAT  240
PKSVLELMDV KDLTLAHVKS HLQMYRTVKT TDRAAANSSG QTDVFDNGSS GETSDDLVIE  300
VANPKRPELG RHDYQDTNQH GLWSNSSREA WLHGKPKDSG GSTPSVEKDM DPKISSYERT  360
SEISSPSVNL TGTSPMKLNL EFTLGRPH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055266.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ93WJ95e-54KAN1_ARATH; Transcription repressor KAN1
TrEMBLA0A059C0280.0A0A059C028_EUCGR; Uncharacterized protein
STRINGVIT_02s0012g01940.t011e-139(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-73G2-like family protein