PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC009087.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 191aa    MW: 21838.4 Da    PI: 9.8162
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC009087.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.81.2e-171564150
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                  k++en+  + +tfskRr gi KKA+EL +LC+ ev v ifs++gk y ++
  EcC009087.10 15 KQVENEEDKLITFSKRRSGIYKKASELVTLCGSEVGVAIFSPSGKPYSFA 64
                  6789*****************************************99997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.114767IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-24766IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-18929IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.19E-24983IPR002100Transcription factor, MADS-box
PfamPF003199.4E-211763IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-182944IPR002100Transcription factor, MADS-box
PRINTSPR004045.2E-184465IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009559Biological Processembryo sac central cell differentiation
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MAGRRTPRRR RVEMKQVENE EDKLITFSKR RSGIYKKASE LVTLCGSEVG VAIFSPSGKP  60
YSFAHPSIDS IATRFRNRNH PQNVGANNLV ESYRRLRIDE LNQQHDELVD QINDDKARGK  120
TLKQMTEERD GEGWWEAPIE ELSLEELKQM KARMVELRRN LQGSITVRNQ GAPSSEGETS  180
NQRNNPSATI T
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059075.11e-140PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLA0A058ZUL31e-137A0A058ZUL3_EUCGR; Uncharacterized protein
STRINGXP_010059075.11e-139(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-39AGAMOUS-like 61