PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC008336.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 243aa    MW: 26709.6 Da    PI: 6.3679
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC008336.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF72.53.6e-232370148
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                  k+i nks +qvtfskRr g++KKA+EL+vLC+a++a+i+fs+  k++ 
  EcC008336.10 23 KKITNKSSQQVTFSKRRSGLFKKASELCVLCGAQIAIIVFSPVHKIFC 70
                  689**************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.7771575IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-321574IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.16E-281690IPR002100Transcription factor, MADS-box
CDDcd002651.37E-351684No hitNo description
PRINTSPR004042.0E-201737IPR002100Transcription factor, MADS-box
PfamPF003192.4E-232471IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-203752IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-205273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009960Biological Processendosperm development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MVVVKKLTKT PKPSKGRKKI EIKKITNKSS QQVTFSKRRS GLFKKASELC VLCGAQIAII  60
VFSPVHKIFC FGHPNVDFVV DRYLREMITD APQDGGEEGG AIVVDNIVPA LHALNEEYDD  120
VLQELAREKQ RGVQLKGGER VRMGGGSSSS GSGRFWWDKP LDDDMAAEEL EQYVVAVEEL  180
MQKVAMKADD MMMRSLLQPY GATVGAAANT AEAGDADMVV NHLVHENEGK FNDYGQIGGP  240
GFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A1e-151683269MEF2C
5f28_B1e-151683269MEF2C
5f28_C1e-151683269MEF2C
5f28_D1e-151683269MEF2C
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018733022.11e-77PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A059BBR51e-146A0A059BBR5_EUCGR; Uncharacterized protein
STRINGXP_010068351.11e-140(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.17e-36AGAMOUS-like 62